PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G202000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 741aa    MW: 81733.3 Da    PI: 6.8728
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G202000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095255621954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Aqcoe5G202000.2.p 525 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 562
                        664459******************************88 PP

2BELL119.12e-38385455272
               BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        + e q+kka Ll++l+eVd+rY++y+eq+q+v++sF+ v+g+g+a+pYt lA+ka+SrhFrcLkdai++q+
  Aqcoe5G202000.2.p 385 KIEYQRKKAALLTMLDEVDRRYNHYCEQMQMVVNSFDSVMGYGAATPYTVLAQKAMSRHFRCLKDAIVGQL 455
                        6799****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-72313453IPR006563POX domain
PfamPF075261.7E-51319452IPR006563POX domain
PROSITE profilePS5007112.536503566IPR001356Homeobox domain
SMARTSM003892.5E-9506570IPR001356Homeobox domain
CDDcd000862.80E-12506567No hitNo description
SuperFamilySSF466893.94E-17508573IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-28509572IPR009057Homeodomain-like
PfamPF059203.7E-18523562IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MHQDQEVQEQ HMVQHRNKLS VQGLEPPPTL VVESGELPVY ESAGTMLSEM FNFQSGATPP  60
AELLDSQITE NYRLHRSLTN TEWYGNRHGM VGGLGPLGDT KQQHHGSSTS TIPQHHHHHH  120
ISSINADSAT AMQLFLMNPS QQPRSPNSPN TPTSSTPLHL LLPNSSTTPP PSLQVFHSAG  180
ATDHHHHQAS FGSTSIPQTQ FTWISGSGGG ENSGTQQLYG NHRTGGDVVE GQGQGLSLSL  240
SSLKHLEAVK AEEMRMGEGS VVYYNQGSSS SSSPSYHMKN LGLHHHQPLH LDGIVQNQNQ  300
QQQVHVGYST SSFGVINLLR NSKYAKAAQE LLEEFCSVGR GHMKNKMRLG RPNTNQSSGG  360
GGGGSTGRES SSFTKDPPPL SAADKIEYQR KKAALLTMLD EVDRRYNHYC EQMQMVVNSF  420
DSVMGYGAAT PYTVLAQKAM SRHFRCLKDA IVGQLKVIRE LVGEKEGGAG SSGITKGETP  480
RLKLLDQSLR QQRAFHQMGI MDQEAWRPQR GLPERSVTIL RAWLFEHFLH PYPSDADKHL  540
LARQTGLSRN QVSNWFINAR VRLWKPMVEE MYNQESKEEE EENGEERERV EKDQSNSSAQ  600
TPTPSTTTTT TTTTAQPTTA RGRRSDAFEN DSSLNAINRQ CFSENQANQI TTTTTNSSYN  660
DLSPTMLRRF HQVAVDDTRR RGSMVVADYG TTTGADHADP DDSKLIRFGT TTGDVSLTLG  720
LQHSGNLPEN NQFSVDFESS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16512570563Homeobox protein Meis2
3k2a_B8e-16512570563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254984.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLF6GX070.0F6GX07_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g01020.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-132BEL1-like homeodomain 4